Recombinant Human CYLD
Cat.No. : | CYLD-27021TH |
Product Overview : | Recombinant fragment of Human CYLD with N terminal proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Detected in fetal brain, testis, and skeletal muscle, and at a lower level in adult brain, leukocytes, liver, heart, kidney, spleen, ovary and lung. Isoform 2 is found in all tissues except kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK |
Sequence Similarities : | Belongs to the peptidase C67 family.Contains 3 CAP-Gly domains. |
Gene Name | CYLD cylindromatosis (turban tumor syndrome) [ Homo sapiens ] |
Official Symbol | CYLD |
Synonyms | CYLD; cylindromatosis (turban tumor syndrome); CYLD1; ubiquitin carboxyl-terminal hydrolase CYLD; KIAA0849; ubiquitin specific peptidase like 2; USPL2; |
Gene ID | 1540 |
mRNA Refseq | NM_015247 |
Protein Refseq | NP_056062 |
MIM | 605018 |
Uniprot ID | Q9NQC7 |
Chromosome Location | 16q12-q13 |
Pathway | Canonical NF-kappaB pathway, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD1/2 Signaling Pathway, organism-specific biosystem; Negative regulators of RIG-I/MDA5 signaling, organism-specific biosystem; |
Function | cysteine-type peptidase activity; metal ion binding; peptidase activity; proline-rich region binding; protein binding; |
◆ Recombinant Proteins | ||
CYLD-124H | Recombinant Human CYLD lysine 63 deubiquitinase Protein, His tagged | +Inquiry |
CYLD-23H | Active Recombinant Human CYLD Protein, His-tagged | +Inquiry |
Cyld-653M | Recombinant Mouse Cyld protein, His&Myc-tagged | +Inquiry |
CYLD-1371R | Recombinant Rat CYLD Protein, His (Fc)-Avi-tagged | +Inquiry |
CYLD-3581H | Recombinant Human CYLD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYLD Products
Required fields are marked with *
My Review for All CYLD Products
Required fields are marked with *
0
Inquiry Basket