Recombinant Human CYLD

Cat.No. : CYLD-27021TH
Product Overview : Recombinant fragment of Human CYLD with N terminal proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Detected in fetal brain, testis, and skeletal muscle, and at a lower level in adult brain, leukocytes, liver, heart, kidney, spleen, ovary and lung. Isoform 2 is found in all tissues except kidney.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Sequence Similarities : Belongs to the peptidase C67 family.Contains 3 CAP-Gly domains.
Gene Name CYLD cylindromatosis (turban tumor syndrome) [ Homo sapiens ]
Official Symbol CYLD
Synonyms CYLD; cylindromatosis (turban tumor syndrome); CYLD1; ubiquitin carboxyl-terminal hydrolase CYLD; KIAA0849; ubiquitin specific peptidase like 2; USPL2;
Gene ID 1540
mRNA Refseq NM_015247
Protein Refseq NP_056062
MIM 605018
Uniprot ID Q9NQC7
Chromosome Location 16q12-q13
Pathway Canonical NF-kappaB pathway, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD1/2 Signaling Pathway, organism-specific biosystem; Negative regulators of RIG-I/MDA5 signaling, organism-specific biosystem;
Function cysteine-type peptidase activity; metal ion binding; peptidase activity; proline-rich region binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYLD Products

Required fields are marked with *

My Review for All CYLD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon