Recombinant Mouse Cyld protein, His&Myc-tagged
| Cat.No. : | Cyld-653M |
| Product Overview : | Recombinant Mouse Cyld protein(Q80TQ2)(579-952aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 579-952aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.6 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVLLRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK |
| Gene Name | Cyld cylindromatosis (turban tumor syndrome) [ Mus musculus ] |
| Official Symbol | Cyld |
| Synonyms | CYLD; cylindromatosis (turban tumor syndrome); ubiquitin carboxyl-terminal hydrolase CYLD; ubiquitin thioesterase CYLD; deubiquitinating enzyme CYLD; ubiquitin thiolesterase CYLD; ubiquitin-specific-processing protease CYLD; probable ubiquitin carboxyl-terminal hydrolase CYLD; EAC; CDMT; CYLD1; mKIAA0849; 2010013M14Rik; 2900009M21Rik; C130039D01Rik; |
| Gene ID | 74256 |
| mRNA Refseq | NM_001128169 |
| Protein Refseq | NP_001121641 |
| ◆ Recombinant Proteins | ||
| CYLD-14H | Active Recombinant Full Length Human CYLD Protein, GST tagged | +Inquiry |
| CYLD-6438H | Recombinant Human CYLD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CYLD-3393H | Recombinant Human CYLD Protein, MYC/DDK-tagged | +Inquiry |
| Cyld-653M | Recombinant Mouse Cyld protein, His&Myc-tagged | +Inquiry |
| CYLD-1371R | Recombinant Rat CYLD Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cyld Products
Required fields are marked with *
My Review for All Cyld Products
Required fields are marked with *




