Active Recombinant Human DEFB1 Protein

• Cat.No.: DEFB1-197H
• Product Overview: Recombinant Human DEFB1 was expressed in E. coli.

Specification

• Description: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis.
• Source: E. coli
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bio-activity: Determined by its ability to chemoattract CD34+ dendritic cells using a concentration range of 100.0-1000.0 ng/ml.
• Molecular Mass: 3.9 kDa
• AA Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: DEFB1 defensin, beta 1 [ Homo sapiens ]
• Official Symbol: DEFB1
• Synonyms: DEFB1; defensin, beta 1; beta-defensin 1; BD1; DEFB 1; DEFB101; HBD 1; HBD1; MGC51822; BD-1; beta-defensin-1; DEFB-1
• Gene ID: 1672
• mRNA Refseq: NM_005218
• Protein Refseq: NP_005209
• MIM: 602056
• UniProt ID: P60022

Reviews

03/12/2023

the stability of the DEFB1 protein enables me to conduct experiments over an extended period, reducing the need for frequent restocking and promoting experimental consistency.

02/06/2019

The DEFB1 protein offers significant advantages in trials due to its high quality, purity, and stability.

01/22/2018

the manufacturer's exceptional support greatly enhances my research process.

Q&As

Can DEFB1 be a potential therapeutic target for infectious diseases?

Yes, the antimicrobial properties of DEFB1 make it a potential target for the development of novel therapeutics against various infectious diseases.

Can DEFB1 be used in combination with conventional antibiotics?

Research suggests that combining DEFB1 with conventional antibiotics may enhance the overall antimicrobial activity and reduce the risk of antibiotic resistance.

How does DEFB1 interact with the microbiome?

DEFB1 plays a role in maintaining the balance of the microbiome by preventing the overgrowth of harmful microorganisms. It contributes to the dynamic equilibrium in the microbial community.

Is DEFB1 involved in cancer development or suppression?

Some studies suggest that DEFB1 may have a role in cancer, with evidence indicating both tumor-promoting and tumor-suppressing effects depending on the specific context.

Is there a genetic component to DEFB1 expression?

Yes, variations in the DEFB1 gene can influence its expression levels, impacting an individual's susceptibility to certain infections and inflammatory conditions.