"DEFB1" Related Products

Expand
Expand
Expand

Recombinant Human DEFB1 Protein

Cat.No. : DEFB1-197H
Product Overview : Recombinant Human DEFB1 was expressed in E. coli.
Description : Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis.
Source : E. coli
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bio-activity : Determined by its ability to chemoattract CD34+ dendritic cells using a concentration range of 100.0-1000.0 ng/ml.
Molecular Mass : 3.9 kDa
AA Sequence : DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name : DEFB1 defensin, beta 1 [ Homo sapiens ]
Official Symbol : DEFB1
Synonyms : DEFB1; defensin, beta 1; beta-defensin 1; BD1; DEFB 1; DEFB101; HBD 1; HBD1; MGC51822; BD-1; beta-defensin-1; DEFB-1;
Gene ID : 1672
mRNA Refseq : NM_005218
Protein Refseq : NP_005209
MIM : 602056
UniProt ID : P60022

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.