Recombinant Human DGAT2 Protein, GST-tagged
Cat.No. : | DGAT2-001H |
Product Overview : | Human DGAT2 full-length ORF ( NP_115953.2, 1 a.a. - 388 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 70.2 kDa |
AA Sequence : | MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DGAT2 diacylglycerol O-acyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | DGAT2 |
Synonyms | DGAT2; diacylglycerol O-acyltransferase 2; ARAT; HMFN1045; GS1999FULL; diacylglycerol O-acyltransferase 2; acyl-CoA retinol O-fatty-acyltransferase; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; diglyceride acyltransferase 2; EC 2.3.1.20; EC 2.3.1.76 |
Gene ID | 84649 |
mRNA Refseq | NM_032564 |
Protein Refseq | NP_115953 |
MIM | 606983 |
UniProt ID | Q96PD7 |
◆ Cell & Tissue Lysates | ||
DGAT2-6965HCL | Recombinant Human DGAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGAT2 Products
Required fields are marked with *
My Review for All DGAT2 Products
Required fields are marked with *
0
Inquiry Basket