Recombinant Full Length Xenopus Tropicalis Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged
Cat.No. : | RFL11813XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Diacylglycerol O-acyltransferase 2(dgat2) Protein (Q6P342) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MKTIIAAYSGVLRGTGSSLLSAVHDLPNIPWLSKSSVVRHLQIISVLQWVLSFLILGVAC TAVLVYIFCTDLWLIAALYLTWMVLDWNTPYKGGRRSSWVRNWAVWRYFRDYFPIKLVKT HNLLPSRNYIFGYHPHGIMCLGAFCNFGTEATGVSKKFPGIKCHLATLAGNFRMPVLREY LMSGGICPVARDTIDYILSKNGTGNAVVIAVGGAAESLNCRPGKNTVTLKQRKGFVKVAL QHGADLVPVYSFGENEAYKQVVFEEGSWGRWIQKKFQKYVGFAPCLFHGCSFFSSNSWGL VPYANPITTVVGEPITVPKIEQPTQKDVELYHAMYVTSLQRLFDKYKTKLGLHDSEMLEI V |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgat2 |
Synonyms | dgat2; TEgg014n15.1; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2 |
UniProt ID | Q6P342 |
◆ Recombinant Proteins | ||
RFL7604BF | Recombinant Full Length Bovine Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged | +Inquiry |
DGAT2-6906HF | Recombinant Full Length Human DGAT2 Protein, GST-tagged | +Inquiry |
RFL18274HF | Recombinant Full Length Human Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged | +Inquiry |
DGAT2-1853R | Recombinant Rat DGAT2 Protein | +Inquiry |
DGAT2-4536M | Recombinant Mouse DGAT2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGAT2-6965HCL | Recombinant Human DGAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dgat2 Products
Required fields are marked with *
My Review for All dgat2 Products
Required fields are marked with *
0
Inquiry Basket