Recombinant Human DGKG Protein (1-255 aa), His-SUMO-tagged

Cat.No. : DGKG-454H
Product Overview : Recombinant Human DGKG Protein (1-255 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-255 aa
Description : Reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 44.9 kDa
AA Sequence : MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name DGKG diacylglycerol kinase, gamma 90kDa [ Homo sapiens ]
Official Symbol DGKG
Synonyms DGKG; DAGK3; DGK-GAMMA; MGC104993; MGC133330;
Gene ID 1608
mRNA Refseq NM_001080744
Protein Refseq NP_001074213
MIM 601854
UniProt ID P49619

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGKG Products

Required fields are marked with *

My Review for All DGKG Products

Required fields are marked with *

0
cart-icon