Recombinant Human DGKG Protein (1-255 aa), His-SUMO-tagged
Cat.No. : | DGKG-454H |
Product Overview : | Recombinant Human DGKG Protein (1-255 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-255 aa |
Description : | Reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | DGKG diacylglycerol kinase, gamma 90kDa [ Homo sapiens ] |
Official Symbol | DGKG |
Synonyms | DGKG; DAGK3; DGK-GAMMA; MGC104993; MGC133330; |
Gene ID | 1608 |
mRNA Refseq | NM_001080744 |
Protein Refseq | NP_001074213 |
MIM | 601854 |
UniProt ID | P49619 |
◆ Recombinant Proteins | ||
Dgkg-1363R | Recombinant Rat Dgkg protein, His & T7-tagged | +Inquiry |
DGKG-454H | Recombinant Human DGKG Protein (1-255 aa), His-SUMO-tagged | +Inquiry |
DGKG-15H | Recombinant Active Human DGKG Protein, His-tagged | +Inquiry |
DGKG-1514R | Recombinant Rat DGKG Protein, His (Fc)-Avi-tagged | +Inquiry |
Dgkg-1362M | Recombinant Mouse Dgkg protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKG-6956HCL | Recombinant Human DGKG 293 Cell Lysate | +Inquiry |
DGKG-6955HCL | Recombinant Human DGKG 293 Cell Lysate | +Inquiry |
DGKG-6954HCL | Recombinant Human DGKG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGKG Products
Required fields are marked with *
My Review for All DGKG Products
Required fields are marked with *