Recombinant Human DGKG Protein (1-255 aa), His-SUMO-tagged
| Cat.No. : | DGKG-454H |
| Product Overview : | Recombinant Human DGKG Protein (1-255 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-255 aa |
| Description : | Reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 44.9 kDa |
| AA Sequence : | MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | DGKG diacylglycerol kinase, gamma 90kDa [ Homo sapiens ] |
| Official Symbol | DGKG |
| Synonyms | DGKG; DAGK3; DGK-GAMMA; MGC104993; MGC133330; |
| Gene ID | 1608 |
| mRNA Refseq | NM_001080744 |
| Protein Refseq | NP_001074213 |
| MIM | 601854 |
| UniProt ID | P49619 |
| ◆ Recombinant Proteins | ||
| DGKG-13H | Recombinant Active Human DGKG Protein, His-tagged | +Inquiry |
| DGKG-2499HF | Recombinant Full Length Human DGKG Protein, GST-tagged | +Inquiry |
| Dgkg-1363R | Recombinant Rat Dgkg protein, His & T7-tagged | +Inquiry |
| DGKG-01H | Recombinant Human DGKG Protein, His-tagged | +Inquiry |
| DGKG-1856R | Recombinant Rat DGKG Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DGKG-6954HCL | Recombinant Human DGKG 293 Cell Lysate | +Inquiry |
| DGKG-6955HCL | Recombinant Human DGKG 293 Cell Lysate | +Inquiry |
| DGKG-6956HCL | Recombinant Human DGKG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGKG Products
Required fields are marked with *
My Review for All DGKG Products
Required fields are marked with *



