Recombinant Human DKK1 Protein, GST-tagged
Cat.No. : | DKK1-2663H |
Product Overview : | Human DKK1 full-length ORF ( AAH01539.1, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 55.00 kDa |
AA Sequence : | MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | DKK1 |
Synonyms | DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1; |
Gene ID | 22943 |
mRNA Refseq | NM_012242 |
Protein Refseq | NP_036374 |
MIM | 605189 |
UniProt ID | O94907 |
◆ Recombinant Proteins | ||
DKK1-278H | Active Recombinant Human DKK1 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
DKK1-1965R | Recombinant Rhesus DKK1 protein, mFc-tagged | +Inquiry |
DKK1-1069H | Active Recombinant Human DKK1 Protein, Biotinylated | +Inquiry |
DKK1-386H | Active Recombinant Human DKK1, HIgG1 Fc-tagged | +Inquiry |
DKK1-1702H | Recombinant Human DKK1 protein, hFc-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
DKK1-2622RCL | Recombinant Rhesus DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK1 Products
Required fields are marked with *
My Review for All DKK1 Products
Required fields are marked with *
0
Inquiry Basket