Recombinant Mouse Dkk1 Protein, His-tagged

Cat.No. : Dkk1-15M
Product Overview : Recombinant mouse Dkk-1 (32-272aa, 247aa), fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 32-272
Description : Predicted to enable co-receptor binding activity; low-density lipoprotein particle receptor binding activity; and receptor antagonist activity. Involved in several processes, including modulation of age-related behavioral decline; negative regulation of cellular component organization; and positive regulation of macromolecule metabolic process. Acts upstream of or within several processes, including Wnt signaling pathway involved in somitogenesis; embryonic morphogenesis; and negative regulation of signal transduction. Predicted to be located in extracellular region and plasma membrane. Predicted to be active in extracellular space. Is expressed in several structures, including alimentary system; embryo mesenchyme; eye; genitourinary system; and nervous system. Human ortholog(s) of this gene implicated in anodontia. Orthologous to human DKK1 (dickkopf WNT signaling pathway inhibitor 1).
Form : Liquid
Molecular Mass : 26.9 kDa
AA Sequence : TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQR
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : 50 mM MES buffer (pH 6.5) containing 30% glycerol
Gene Name Dkk1 dickkopf WNT signaling pathway inhibitor 1 [ Mus musculus (house mouse) ]
Official Symbol Dkk1
Synonyms Dkk1; dickkopf WNT signaling pathway inhibitor 1; mdkk-1; dickkopf-related protein 1; dickkopf homolog 1; dickkopf-1; dickkopf-like protein 1; dkk-1
Gene ID 13380
mRNA Refseq NM_010051
Protein Refseq NP_034181
UniProt ID O54908

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Dkk1 Products

Required fields are marked with *

My Review for All Dkk1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon