Recombinant Mouse Dkk1 Protein, His-tagged
Cat.No. : | Dkk1-15M |
Product Overview : | Recombinant mouse Dkk-1 (32-272aa, 247aa), fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 32-272 |
Description : | Predicted to enable co-receptor binding activity; low-density lipoprotein particle receptor binding activity; and receptor antagonist activity. Involved in several processes, including modulation of age-related behavioral decline; negative regulation of cellular component organization; and positive regulation of macromolecule metabolic process. Acts upstream of or within several processes, including Wnt signaling pathway involved in somitogenesis; embryonic morphogenesis; and negative regulation of signal transduction. Predicted to be located in extracellular region and plasma membrane. Predicted to be active in extracellular space. Is expressed in several structures, including alimentary system; embryo mesenchyme; eye; genitourinary system; and nervous system. Human ortholog(s) of this gene implicated in anodontia. Orthologous to human DKK1 (dickkopf WNT signaling pathway inhibitor 1). |
Form : | Liquid |
Molecular Mass : | 26.9 kDa |
AA Sequence : | TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQR |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | 50 mM MES buffer (pH 6.5) containing 30% glycerol |
Gene Name | Dkk1 dickkopf WNT signaling pathway inhibitor 1 [ Mus musculus (house mouse) ] |
Official Symbol | Dkk1 |
Synonyms | Dkk1; dickkopf WNT signaling pathway inhibitor 1; mdkk-1; dickkopf-related protein 1; dickkopf homolog 1; dickkopf-1; dickkopf-like protein 1; dkk-1 |
Gene ID | 13380 |
mRNA Refseq | NM_010051 |
Protein Refseq | NP_034181 |
UniProt ID | O54908 |
◆ Recombinant Proteins | ||
DKK1-1965R | Recombinant Rhesus DKK1 protein, mFc-tagged | +Inquiry |
DKK1-2491H | Recombinant Human DKK1 protein(32-266 aa), N-His-MBP-His-tagged | +Inquiry |
DKK1-1069H | Active Recombinant Human DKK1 Protein, Biotinylated | +Inquiry |
DKK1-1267H | Acitve Recombinant Human DKK1 protein(Met2-His266), hFc-tagged | +Inquiry |
DKK1-068H | Recombinant Human DKK1 Protein, THR32-HIS266, Tag Free, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
DKK1-2622RCL | Recombinant Rhesus DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Dkk1 Products
Required fields are marked with *
My Review for All Dkk1 Products
Required fields are marked with *
0
Inquiry Basket