Recombinant Human DKK1 Protein, His-tagged

Cat.No. : DKK1-194H
Product Overview : Recombinant human DKK1 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 266
Description : This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibits beta-catenin-dependent Wnt signaling. This gene plays a role in embryonic development and may be important in bone formation in adults. Elevated expression of this gene has been observed in numerous human cancers and this protein may promote proliferation, invasion and growth in cancer cell lines.
Form : Lyophilized
Molecular Mass : 25.8 kDa
AA Sequence : MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens (human) ]
Official Symbol DKK1
Synonyms DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1;
Gene ID 22943
mRNA Refseq NM_012242
Protein Refseq NP_036374
MIM 605189
UniProt ID O94907

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DKK1 Products

Required fields are marked with *

My Review for All DKK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon