"DLL3" Related Products

Expand
Expand

Recombinant Human DLL3 Protein, His-SUMO-tagged

Cat.No. : DLL3-1189H
Product Overview : Recombinant Human DLL3 Protein (2-492aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
Source : E. coli
Species : Human
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 64.5 kDa
AA Sequence : AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : DLL3 delta like canonical Notch ligand 3 [ Homo sapiens (human) ]
Official Symbol : DLL3
Synonyms : SCDO1; DLL3; delta like canonical Notch ligand 3; Drosophila Delta homolog 3 ;Delta3
Gene ID : 10683
mRNA Refseq : NM_016941.3
Protein Refseq : NP_058637.1
MIM : 602768
UniProt ID : Q9NYJ7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.