Recombinant Human DLL3 Protein, His-SUMO-tagged
Cat.No. : | DLL3-1189H |
Product Overview : | Recombinant Human DLL3 Protein (2-492aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-492 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 64.5 kDa |
AA Sequence : | AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | DLL3 delta like canonical Notch ligand 3 [ Homo sapiens (human) ] |
Official Symbol | DLL3 |
Synonyms | SCDO1; DLL3; delta like canonical Notch ligand 3; Drosophila Delta homolog 3 ;Delta3 |
Gene ID | 10683 |
mRNA Refseq | NM_016941.3 |
Protein Refseq | NP_058637.1 |
MIM | 602768 |
UniProt ID | Q9NYJ7 |
◆ Recombinant Proteins | ||
DLL3-1888R | Recombinant Rat DLL3 Protein | +Inquiry |
DLL3-29H | Recombinant Human DLL3 protein(Ala 27 - Leu 492), lFc-tagged | +Inquiry |
DLL3-31H | Recombinant Human DLL3 protein, His-tagged | +Inquiry |
DLL3-856H | Recombinant Human DLL3 Protein, FLAG-tagged | +Inquiry |
DLL3-4632M | Recombinant Mouse DLL3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLL3 Products
Required fields are marked with *
My Review for All DLL3 Products
Required fields are marked with *