Recombinant Human DVL2, GST-tagged
Cat.No. : | DVL2-107H |
Product Overview : | Recombinant Human DVL2(1 a.a. - 736 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans. |
Molecular Mass : | 105.3 kDa |
AA Sequence : | MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDN ARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPE TETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTE QSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPID PAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIP NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDND GSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMAL PYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DVL2 dishevelled, dsh homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | DVL2 |
Synonyms | DVL2; dishevelled, dsh homolog 2 (Drosophila); dishevelled 2 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-2; dishevelled 2 (homologous to Drosophila dsh); Dishevelled dsh homolog 2; Dishevelled-2; Dishevelled2; DSH homolog 2; DVL 2; Dvl2; DVL2_HUMAN; Segment polarity protein dishevelled homolog DVL 2; Segment polarity protein dishevelled homolog DVL-2; Segment polarity protein dishevelled homolog DVL2; DSH homolog 2; dishevelled-2; OTTHUMP00000128349 |
Gene ID | 1856 |
mRNA Refseq | NM_004422 |
Protein Refseq | NP_004413 |
MIM | 602151 |
UniProt ID | O14641 |
Chromosome Location | 17p13.1 |
Pathway | Basal cell carcinoma; Canonical Wnt signaling pathway; DNA damage response (only ATM dependent) |
Function | frizzled binding; identical protein binding; protein binding; protein domain specific binding; protein self-association |
◆ Recombinant Proteins | ||
DVL2-1358R | Recombinant Rhesus monkey DVL2 Protein, His-tagged | +Inquiry |
DVL2-1844H | Recombinant Human DVL2 protein, His-tagged | +Inquiry |
DVL2-107H | Recombinant Human DVL2, GST-tagged | +Inquiry |
DVL2-108H | Recombinant Human DVL2, GST-tagged | +Inquiry |
DVL2-1183R | Recombinant Rhesus Macaque DVL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DVL2-6765HCL | Recombinant Human DVL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DVL2 Products
Required fields are marked with *
My Review for All DVL2 Products
Required fields are marked with *
0
Inquiry Basket