Recombinant Human EDA Protein, His/Flag/StrepII-tagged
Cat.No. : | EDA-3041H |
Product Overview : | Purified EDA (NP_001390.1 245 a.a. - 391 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 245-391 a.a. |
Description : | The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 21.45 kDa |
AA Sequence : | ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS |
Applications : | Western Blot Enzyme-linked Immunoabsorbent Assay SDS-PAGE Protein Interaction Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | EDA ectodysplasin A [ Homo sapiens ] |
Official Symbol | EDA |
Synonyms | EDA; ectodysplasin A; ectodermal dysplasia 1, anhidrotic , ED1, EDA2, ODT1, oligodontia 1; ectodysplasin-A; ED1 A1; ED1 A2; EDA1; HED; XHED; XLHED; oligodontia 1; ectodermal dysplasia protein; X-linked anhidroitic ectodermal dysplasia protein; ED1; EDA2; ODT1; ED1-A1; ED1-A2; STHAGX1; |
Gene ID | 1896 |
mRNA Refseq | NM_001005609 |
Protein Refseq | NP_001005609 |
MIM | 300451 |
UniProt ID | Q92838 |
◆ Recombinant Proteins | ||
EDA-3041H | Recombinant Human EDA Protein, His/Flag/StrepII-tagged | +Inquiry |
EDA-4269H | Recombinant Human EDA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EDA-928H | Recombinant Human EDA Protein, MYC/DDK-tagged | +Inquiry |
EDA-2082H | Recombinant Human Ectodysplasin A, FLAG-tagged | +Inquiry |
Eda-2722M | Recombinant Mouse Eda Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDA Products
Required fields are marked with *
My Review for All EDA Products
Required fields are marked with *
0
Inquiry Basket