Recombinant Human EIF4EBP2 Protein (1-120 aa), His-tagged
| Cat.No. : | EIF4EBP2-1386H |
| Product Overview : | Recombinant Human EIF4EBP2 Protein (1-120 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-120 aa |
| Description : | Repressor of translation initiation involved in synaptic plasticity, learning and mory formation . Regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation . EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal st cell renewal via its ability to repress translation initiation . Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.9 kDa |
| AA Sequence : | MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ] |
| Official Symbol | EIF4EBP2 |
| Synonyms | EIF4EBP2; 4E-BP2; 4EBP2; PHASII; |
| Gene ID | 1979 |
| mRNA Refseq | NM_004096 |
| Protein Refseq | NP_004087 |
| MIM | 602224 |
| UniProt ID | Q13542 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP2 Products
Required fields are marked with *
My Review for All EIF4EBP2 Products
Required fields are marked with *



