Recombinant Human EIF4EBP2 Protein (1-120 aa), His-tagged
Cat.No. : | EIF4EBP2-1386H |
Product Overview : | Recombinant Human EIF4EBP2 Protein (1-120 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-120 aa |
Description : | Repressor of translation initiation involved in synaptic plasticity, learning and mory formation . Regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation . EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal st cell renewal via its ability to repress translation initiation . Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ] |
Official Symbol | EIF4EBP2 |
Synonyms | EIF4EBP2; 4E-BP2; 4EBP2; PHASII; |
Gene ID | 1979 |
mRNA Refseq | NM_004096 |
Protein Refseq | NP_004087 |
MIM | 602224 |
UniProt ID | Q13542 |
◆ Recombinant Proteins | ||
EIF4EBP2-28493TH | Recombinant Human EIF4EBP2, His-tagged | +Inquiry |
EIF4EBP2-1386H | Recombinant Human EIF4EBP2 Protein (1-120 aa), His-tagged | +Inquiry |
EIF4EBP2-4999H | Recombinant Human Eukaryotic Translation Initiation Factor 4E Binding Protein 2, His-tagged | +Inquiry |
EIF4EBP2-3204H | Recombinant Human EIF4EBP2 Protein, GST-tagged | +Inquiry |
EIF4EBP2-5173H | Recombinant Human EIF4EBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4EBP2-6648HCL | Recombinant Human EIF4EBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP2 Products
Required fields are marked with *
My Review for All EIF4EBP2 Products
Required fields are marked with *
0
Inquiry Basket