Recombinant Human EIF4EBP2 Protein, GST-tagged
Cat.No. : | EIF4EBP2-3204H |
Product Overview : | Human EIF4EBP2 full-length ORF ( AAH05057, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 38.94 kDa |
AA Sequence : | MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ] |
Official Symbol | EIF4EBP2 |
Synonyms | EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2; 4E-BP2; eIF4E-binding protein 2; phosphorylated, heat and acid stable regulated by insulin protein II; 4EBP2; PHASII; |
Gene ID | 1979 |
mRNA Refseq | NM_004096 |
Protein Refseq | NP_004087 |
MIM | 602224 |
UniProt ID | Q13542 |
◆ Recombinant Proteins | ||
EIF4EBP2-4294HF | Recombinant Full Length Human EIF4EBP2 Protein, GST-tagged | +Inquiry |
EIF4EBP2-5111M | Recombinant Mouse EIF4EBP2 Protein | +Inquiry |
EIF4EBP2-1255R | Recombinant Rhesus Macaque EIF4EBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4EBP2-1431R | Recombinant Rhesus monkey EIF4EBP2 Protein, His-tagged | +Inquiry |
EIF4EBP2-5173H | Recombinant Human EIF4EBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4EBP2-6648HCL | Recombinant Human EIF4EBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP2 Products
Required fields are marked with *
My Review for All EIF4EBP2 Products
Required fields are marked with *