Recombinant Human ELAVL3 Protein, GST-tagged
Cat.No. : | ELAVL3-3233H |
Product Overview : | Human ELAVL3 full-length ORF ( AAH11875, 1 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 66.11 kDa |
AA Sequence : | MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAIDTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPRTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELAVL3 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C) [ Homo sapiens ] |
Official Symbol | ELAVL3 |
Synonyms | ELAVL3; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C); HUC; HUCL; PLE21 |
Gene ID | 1995 |
mRNA Refseq | NM_032281 |
Protein Refseq | NP_115657 |
MIM | 603458 |
UniProt ID | Q14576 |
◆ Recombinant Proteins | ||
ELAVL3-1006H | Recombinant Human ELAVL3 Protein (1-367 aa), His-tagged | +Inquiry |
ELAVL3-2154HFL | Recombinant Full Length Human ELAVL3 Protein, C-Flag-tagged | +Inquiry |
ELAVL3-1653H | Recombinant Human ELAVL3 Protein (1-367 aa), His-tagged | +Inquiry |
ELAVL3-4338HF | Recombinant Full Length Human ELAVL3 Protein, GST-tagged | +Inquiry |
ELAVL3-2732M | Recombinant Mouse ELAVL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELAVL3-6636HCL | Recombinant Human ELAVL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELAVL3 Products
Required fields are marked with *
My Review for All ELAVL3 Products
Required fields are marked with *
0
Inquiry Basket