Recombinant Human ENO1

Cat.No. : ENO1-28561TH
Product Overview : Recombinant full length Human ENO1 expressed in Saccharomyces cerevisiae; 434 amino acids, MWt 47.1 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy.
Tissue specificity : The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGAS TGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALV SKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGG SHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKN VIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYIS PDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTAS AGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGL CTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGR NFRNPLAK
Sequence Similarities : Belongs to the enolase family.
Full Length : Full L.
Gene Name ENO1 enolase 1, (alpha) [ Homo sapiens ]
Official Symbol ENO1
Synonyms ENO1; enolase 1, (alpha); ENO1L1, MPB1; alpha-enolase; c-myc promoter-binding protein-1; MBP 1; PPH;
Gene ID 2023
mRNA Refseq NM_001201483
Protein Refseq NP_001188412
MIM 172430
Uniprot ID P06733
Chromosome Location 1p36.2
Pathway Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem;
Function DNA binding; lyase activity; magnesium ion binding; phosphopyruvate hydratase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENO1 Products

Required fields are marked with *

My Review for All ENO1 Products

Required fields are marked with *

0
cart-icon