Recombinant Human EPCAM Protein, His/Flag/StrepII-tagged
Cat.No. : | EPCAM-3368H |
Product Overview : | Purified EPCAM (NP_002345.1 24 a.a. - 265 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 24-265 a.a. |
Description : | This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 31.9 kDa |
AA Sequence : | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
Applications : | Western Blot Enzyme-linked Immunoabsorbent Assay SDS-PAGE Protein Interaction |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens ] |
Official Symbol | EPCAM |
Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2; |
Gene ID | 4072 |
mRNA Refseq | NM_002354 |
Protein Refseq | NP_002345 |
MIM | 185535 |
UniProt ID | P16422 |
◆ Recombinant Proteins | ||
EPCAM-220H | Recombinant Human EPCAM Protein, His-tagged, Biotinylated | +Inquiry |
RFL13291HF | Recombinant Full Length Human Epithelial Cell Adhesion Molecule(Epcam) Protein, His-Tagged | +Inquiry |
Epcam-7482R | Recombinant Rat Epcam protein(Met1-Thr266), His-tagged | +Inquiry |
EPCAM-207H | Recombinant Human EPCAM Protein, His\Avi-tagged | +Inquiry |
EPCAM-202CAF647 | Recombinant Monkey EPCAM Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *
0
Inquiry Basket