Recombinant Human EPCAM Protein, His-tagged, Biotinylated
| Cat.No. : | EPCAM-220H |
| Product Overview : | Biotinylated Recombinant human EPCAM protein with His tag was expressed in HEK293.. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 314 |
| Description : | This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. |
| Form : | Lyophilized |
| Molecular Mass : | 29 kDa |
| AA Sequence : | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Conjugation : | Biotin |
| Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens (human) ] |
| Official Symbol | EPCAM |
| Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2; |
| Gene ID | 4072 |
| mRNA Refseq | NM_002354 |
| Protein Refseq | NP_002345 |
| MIM | 185535 |
| UniProt ID | P16422 |
| ◆ Recombinant Proteins | ||
| Epcam-7482RAF647 | Recombinant Rat Epcam Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| Epcam-7481R | Recombinant Rat Epcam protein, hFc-tagged | +Inquiry |
| Epcam-7481RP | Recombinant Rat Epcam protein, Fc-tagged, R-PE labeled | +Inquiry |
| EPCAM-65H | Recombinant Human EPCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| Epcam-7481RAF488 | Recombinant Rat Epcam Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
| EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
| EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
| EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *
