Recombinant Human EPHA7 Protein, GST-tagged
Cat.No. : | EPHA7-3394H |
Product Overview : | Human EPHA7 full-length ORF ( AAH27940.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Increased expression of this gene is associated with multiple forms of carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013] |
Molecular Mass : | 56.32 kDa |
AA Sequence : | MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPHA7 EPH receptor A7 [ Homo sapiens ] |
Official Symbol | EPHA7 |
Synonyms | EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11; EK11; EHK-3; EPH-like kinase 11; EPH homology kinase 3; Eph homology kinase-3; receptor protein-tyrosine kinase HEK11; tyrosine-protein kinase receptor EHK-3; EHK3; HEK11; |
Gene ID | 2045 |
mRNA Refseq | NM_004440 |
Protein Refseq | NP_004431 |
MIM | 602190 |
UniProt ID | Q15375 |
◆ Recombinant Proteins | ||
EPHA7-1778R | Recombinant Rat EPHA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
EphA7-1255R | Acitve Recombinant Rat EphA7 protein(Met1-Ser539), His-tagged | +Inquiry |
EPHA7-226H | Recombinant Human EPHA7 Protein, His-tagged | +Inquiry |
Epha7-1079R | Active Recombinant Rat Epha7 Protein, Fc-tagged | +Inquiry |
EPHA7-369H | Recombinant Human EPHA7 Protein, DDK/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA7-414HCL | Recombinant Human EPHA7 cell lysate | +Inquiry |
EPHA7-2236HCL | Recombinant Human EPHA7 cell lysate | +Inquiry |
EPHA7-1100RCL | Recombinant Rat EPHA7 cell lysate | +Inquiry |
EPHA7-2125MCL | Recombinant Mouse EPHA7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPHA7 Products
Required fields are marked with *
My Review for All EPHA7 Products
Required fields are marked with *
0
Inquiry Basket