Recombinant Human EPHA7 Protein, GST-tagged

Cat.No. : EPHA7-3394H
Product Overview : Human EPHA7 full-length ORF ( AAH27940.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Increased expression of this gene is associated with multiple forms of carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
Molecular Mass : 56.32 kDa
AA Sequence : MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EPHA7 EPH receptor A7 [ Homo sapiens ]
Official Symbol EPHA7
Synonyms EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11; EK11; EHK-3; EPH-like kinase 11; EPH homology kinase 3; Eph homology kinase-3; receptor protein-tyrosine kinase HEK11; tyrosine-protein kinase receptor EHK-3; EHK3; HEK11;
Gene ID 2045
mRNA Refseq NM_004440
Protein Refseq NP_004431
MIM 602190
UniProt ID Q15375

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPHA7 Products

Required fields are marked with *

My Review for All EPHA7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon