Recombinant Human FABP1 Protein, GST-tagged
Cat.No. : | FABP1-3629H |
Product Overview : | Human FABP1 full-length ORF ( AAH32801, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011] |
Molecular Mass : | 39.71 kDa |
AA Sequence : | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FABP1 fatty acid binding protein 1, liver [ Homo sapiens ] |
Official Symbol | FABP1 |
Synonyms | FABP1; fatty acid binding protein 1, liver; fatty acid-binding protein, liver; L FABP; fatty acid-binding protein 1; liver-type fatty acid-binding protein; FABPL; L-FABP; |
Gene ID | 2168 |
mRNA Refseq | NM_001443 |
Protein Refseq | NP_001434 |
MIM | 134650 |
UniProt ID | P07148 |
◆ Recombinant Proteins | ||
FABP1-2971H | Recombinant Human FABP1 Protein (Ser2-Ile127), His tagged | +Inquiry |
FABP1-7124C | Recombinant Cattle FABP1 protein, His-tagged | +Inquiry |
FABP1-5766C | Recombinant Chicken FABP1 | +Inquiry |
FABP1-3685H | Recombinant Human FABP1, His-tagged | +Inquiry |
Fabp1-7126M | Recombinant Mouse Fabp1 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
FABP1-509H | Native Human FABP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP1-6479HCL | Recombinant Human FABP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FABP1 Products
Required fields are marked with *
My Review for All FABP1 Products
Required fields are marked with *
0
Inquiry Basket