Recombinant Human FABP6 Protein, GST-tagged

Cat.No. : FABP6-3637H
Product Overview : Human FABP6 full-length ORF ( AAH22489, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 39.82 kDa
AA Sequence : MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FABP6 fatty acid binding protein 6, ileal [ Homo sapiens ]
Official Symbol FABP6
Synonyms FABP6; fatty acid binding protein 6, ileal; gastrotropin; I 15P; I BABP; I BALB; I BAP; ILBP; ILBP3; ileal bile acid binding protein; ILLBP; illeal lipid binding protein; GT; intestinal 15 kDa protein; ileal lipid-binding protein; illeal lipid-binding protein; I-15P; I-BAP; I-BABP; I-BALB;
Gene ID 2172
mRNA Refseq NM_001040442
Protein Refseq NP_001035532
MIM 600422
UniProt ID P51161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FABP6 Products

Required fields are marked with *

My Review for All FABP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon