Recombinant Human FABP6 Protein, His-tagged
Cat.No. : | FABP6-3676H |
Product Overview : | Recombinant Human FABP6 protein with N-Terminal His-tag (10 extra AA) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 15.5 kDa (calculated) |
AA Sequence : | MKHHHHHHASAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
Endotoxin : | <1.0 EU/μg |
Purity : | Purity as determined by densitometric image analysis: >95% |
Applications : | WB, ELISA |
Quality Control Test : | BCA to determine quantity of the protein. SDS PAGE to determine purity of the protein. LAL to determine quantity of endotoxin. |
Notes : | This product is intended for research use only. |
Storage : | Store lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week. |
Storage Buffer : | Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4 |
Reconstitution : | Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture. |
Gene Name | FABP6 fatty acid binding protein 6 [ Homo sapiens (human) ] |
Official Symbol | FABP6 |
Synonyms | FABP6; GT; Fatty acid-binding protein 6; Ileal lipid-binding protein; ILBP; Intestinal 15 kDa protein; I-15P; Intestinal bile acid-binding protein; I-BABP; ILBP; ILLBP; fatty acid binding protein 6; gastrotropin; fatty acid binding protein 6, ileal; ileal bile acid binding protein; ileal lipid-binding protein; illeal lipid-binding protein; intestinal 15 kDa protein |
Gene ID | 2172 |
mRNA Refseq | NM_001040442 |
Protein Refseq | NP_001035532 |
MIM | 600422 |
UniProt ID | P51161 |
◆ Recombinant Proteins | ||
FABP6-2830H | Recombinant Human FABP6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FABP6-308Z | Recombinant Zebrafish FABP6 | +Inquiry |
FABP6-2929M | Recombinant Mouse FABP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP6-28338TH | Recombinant Human FABP6, His-tagged | +Inquiry |
FABP6-6928H | Recombinant Human FABP6 protein(Met1-Ala128) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP6-6475HCL | Recombinant Human FABP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FABP6 Products
Required fields are marked with *
My Review for All FABP6 Products
Required fields are marked with *
0
Inquiry Basket