Recombinant Human FAS Protein, His/Flag/StrepII-tagged
Cat.No. : | FAS-3851H |
Product Overview : | Purified FAS (AAH12479.1, 25 a.a. - 169 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 25-169 a.a. |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. Several alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated mRNA decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq, Mar 2011] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 21.23 kDa |
AA Sequence : | AQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG |
Applications : | Western Blot Enzyme-linked Immunoabsorbent Assay SDS-PAGE Protein Interaction |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | FAS Fas (TNF receptor superfamily, member 6) [ Homo sapiens ] |
Official Symbol | FAS |
Synonyms | FAS; Fas (TNF receptor superfamily, member 6); APT1, FAS1, TNFRSF6, tumor necrosis factor receptor superfamily, member 6; tumor necrosis factor receptor superfamily member 6; APO 1; CD95; Fas AMA; FAS 827dupA; CD95 antigen; FASLG receptor; apoptosis antigen 1; Delta Fas/APO-1/CD95; APO-1 cell surface antigen; apoptosis-mediating surface antigen FAS; tumor necrosis factor receptor superfamily, member 6; APT1; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6; |
Gene ID | 355 |
mRNA Refseq | NM_000043 |
Protein Refseq | NP_000034 |
MIM | 134637 |
UniProt ID | P25445 |
◆ Recombinant Proteins | ||
FAS-3851H | Recombinant Human FAS Protein, His/Flag/StrepII-tagged | +Inquiry |
RFL6573HF | Recombinant Full Length Human Tumor Necrosis Factor Receptor Superfamily Member 6(Fas) Protein, His-Tagged | +Inquiry |
FAS-2664H | Active Recombinant Human FAS protein, hFc&His-tagged | +Inquiry |
FAS-519H | Active Recombinant Human FAS | +Inquiry |
FAS-2273R | Recombinant Rat FAS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAS-2185HCL | Recombinant Human FAS cell lysate | +Inquiry |
FAS-1139RCL | Recombinant Rat FAS cell lysate | +Inquiry |
FAS-001CCL | Recombinant Cynomolgus FAS cell lysate | +Inquiry |
FAS-2419MCL | Recombinant Mouse FAS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAS Products
Required fields are marked with *
My Review for All FAS Products
Required fields are marked with *
0
Inquiry Basket