Recombinant Human FGL1 Protein, GST-tagged
Cat.No. : | FGL1-4152H |
Product Overview : | Human FGL1 full-length ORF ( AAH07047, 19 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq |
Molecular Mass : | 57.97 kDa |
AA Sequence : | EISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGL1 fibrinogen-like 1 [ Homo sapiens ] |
Official Symbol | FGL1 |
Synonyms | FGL1; fibrinogen-like 1; fibrinogen-like protein 1; HFREP 1; hepassocin; liver fibrinogen-related protein 1; hepatocellular carcinoma-related sequence; hepatocyte-derived fibrinogen-related protein 1; HFREP1; HP-041; LFIRE1; LFIRE-1; MGC12455; |
Gene ID | 2267 |
mRNA Refseq | NM_004467 |
Protein Refseq | NP_004458 |
MIM | 605776 |
UniProt ID | Q08830 |
◆ Recombinant Proteins | ||
FGL1-6654H | Recombinant Human FGL1 protein(179-282aa), His-GST&Myc-tagged | +Inquiry |
FGL1-121H | Recombinant Human FGL1 Protein, MIgG2a Fc-tagged | +Inquiry |
FGL1-911H | Recombinant Human FGL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGL1-1448M | Active Recombinant Mouse FGL1 protein, Fc-tagged | +Inquiry |
FGL1-1453H | Active Recombinant Human FGL1 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGL1-6229HCL | Recombinant Human FGL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGL1 Products
Required fields are marked with *
My Review for All FGL1 Products
Required fields are marked with *
0
Inquiry Basket