Recombinant Human FGL1 protein(179-282aa), His-GST&Myc-tagged
Cat.No. : | FGL1-6654H |
Product Overview : | Recombinant Human FGL1 protein(Q08830)(179-282aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 179-282aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNG |
Gene Name | FGL1 fibrinogen-like 1 [ Homo sapiens ] |
Official Symbol | FGL1 |
Synonyms | FGL1; fibrinogen-like 1; fibrinogen-like protein 1; HFREP 1; hepassocin; liver fibrinogen-related protein 1; hepatocellular carcinoma-related sequence; hepatocyte-derived fibrinogen-related protein 1; HFREP1; HP-041; LFIRE1; LFIRE-1; MGC12455; |
Gene ID | 2267 |
mRNA Refseq | NM_004467 |
Protein Refseq | NP_004458 |
MIM | 605776 |
UniProt ID | Q08830 |
◆ Recombinant Proteins | ||
FGL1-4152H | Recombinant Human FGL1 Protein, GST-tagged | +Inquiry |
FGL1-3287H | Recombinant Human FGL1 Protein (Leu23-Ile312), His tagged | +Inquiry |
FGL1-563C | Recombinant Cynomolgus FGL1 protein, His-tagged | +Inquiry |
FGL1-3244M | Recombinant Mouse FGL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGL1-1942H | Recombinant Human FGL1 protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGL1-6229HCL | Recombinant Human FGL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGL1 Products
Required fields are marked with *
My Review for All FGL1 Products
Required fields are marked with *
0
Inquiry Basket