Species : |
Human |
Source : |
E.coli |
Tag : |
His&T7 |
Description : |
This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined. |
Form : |
Liquid |
AA Sequence : |
MASMTGGQQMGRGHHHHHHGNLYFQGGEFNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVT |
Purity : |
>90% by SDS-PAGE. |
Applications : |
1. May be used for in vitro FN-III EDB domain mediated human endothelial cell or cancer stroma cell differentiation / migration regulations study with this protein as either soluble factor or coating matrix protein. 2. May be used for in vitro protein-protein interaction mapping. 3. As antigen for specific antibody production. |
Storage : |
Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Concentration : |
1.0 mg/mL, sterile-filtered |
Storage Buffer : |
20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol |