Recombinant Bovine FN1 protein(53-273aa), His&Myc-tagged
Cat.No. : | FN1-632B |
Product Overview : | Recombinant Bovine FN1 protein(P07589)(53-273aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 53-273aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CYDNGKHYQINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDQAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCER |
◆ Recombinant Proteins | ||
FN1-32H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
FN1-649H | Recombinant Human FN1 protein, His-tagged | +Inquiry |
FN1-38H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
FN1-517H | Active Recombinant Human FN1, His-tagged | +Inquiry |
FN1-46H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
FN1-28900TH | Native Human FN1 | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
FN1-2708HB | Native Human Fibronectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *
0
Inquiry Basket