Recombinant Human FOLR1 Protein, Strep-tagged
Cat.No. : | FOLR1-252H |
Product Overview : | Recombinant human FOLR1 protein with Strep tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Strep |
Protein Length : | 257 |
Description : | The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | FOLR1 folate receptor 1 (adult) [ Homo sapiens (human) ] |
Official Symbol | FOLR1 |
Synonyms | FOLR1; folate receptor 1 (adult); FOLR; folate receptor alpha; FR-alpha; KB cells FBP; folate binding protein; folate receptor, adult; adult folate-binding protein; ovarian tumor-associated antigen MOv18; FBP; |
Gene ID | 2348 |
mRNA Refseq | NM_000802 |
Protein Refseq | NP_000793 |
MIM | 136430 |
UniProt ID | P15328 |
◆ Recombinant Proteins | ||
FOLR1-1062CAF488 | Recombinant Canine FOLR1 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
FOLR1-5035HF | Recombinant Full Length Human FOLR1 Protein, GST-tagged | +Inquiry |
FOLR1-1062C | Recombinant Canine FOLR1 Protein, Fc-tagged | +Inquiry |
FOLR1-678H | Active Recombinant Human FOLR1 protein, hFc-tagged | +Inquiry |
FOLR1-4148H | Recombinant Human FOLR1 Protein (Met1-Met233), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR1-2103HCL | Recombinant Human FOLR1 cell lysate | +Inquiry |
FOLR1-2113MCL | Recombinant Mouse FOLR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOLR1 Products
Required fields are marked with *
My Review for All FOLR1 Products
Required fields are marked with *
0
Inquiry Basket