Recombinant Full Length Human FOLR1 Protein, GST-tagged
Cat.No. : | FOLR1-5035HF |
Product Overview : | Human FOLR1 full-length ORF ( AAH02947.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 257 amino acids |
Description : | The protein encoded by this gene is a member of the folate receptor (FOLR) family. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene is composed of 7 exons; exons 1 through 4 encode the 5 UTR and exons 4 through 7 encode the open reading frame. Due to the presence of 2 promoters, multiple transcription start sites, and alternative splicing of exons, several transcript variants are derived from this gene. These variants differ in the lengths of 5 and 3 UTR, but they encode an identical amino acid sequence. [provided by RefSeq |
Molecular Mass : | 54.01 kDa |
AA Sequence : | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOLR1 folate receptor 1 (adult) [ Homo sapiens ] |
Official Symbol | FOLR1 |
Synonyms | FOLR1; folate receptor 1 (adult); FOLR; folate receptor alpha; FR-alpha; KB cells FBP; folate binding protein; folate receptor, adult; adult folate-binding protein; ovarian tumor-associated antigen MOv18; FBP; |
Gene ID | 2348 |
mRNA Refseq | NM_000802 |
Protein Refseq | NP_000793 |
MIM | 136430 |
UniProt ID | P15328 |
◆ Recombinant Proteins | ||
Folr1-0630M | Recombinant Mouse Folr1 protein, His-tagged, Biotinylated | +Inquiry |
FOLR1-253M | Recombinant Mouse FOLR1 Protein, His-tagged | +Inquiry |
FOLR1-250R | Recombinant Rhesus macaque FOLR1 Protein, His-tagged | +Inquiry |
FOLR1-030H | Active Recombinant Human FOLR1 protein, His-tagged | +Inquiry |
FOLR1-1146RP | Recombinant Rat FOLR1 protein, Fc-tagged, R-PE labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR1-2103HCL | Recombinant Human FOLR1 cell lysate | +Inquiry |
FOLR1-2113MCL | Recombinant Mouse FOLR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOLR1 Products
Required fields are marked with *
My Review for All FOLR1 Products
Required fields are marked with *