Recombinant Human FOS protein, GST-tagged

Cat.No. : FOS-32H
Product Overview : Recombinant Human FOS(1 a.a. - 380 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-380 a.a.
Description : The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 67.54 kDa
AA Sequence : MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name FOS FBJ murine osteosarcoma viral oncogene homolog [ Homo sapiens ]
Official Symbol FOS
Synonyms FOS; FBJ murine osteosarcoma viral oncogene homolog; v fos FBJ murine osteosarcoma viral oncogene homolog; proto-oncogene c-Fos; AP 1; c fos; activator protein 1; cellular oncogene c-fos; G0/G1 switch regulatory protein 7; FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS); p55; AP-1; C-FOS;
Gene ID 2353
mRNA Refseq NM_005252
Protein Refseq NP_005243
MIM 164810
UniProt ID P01100
Chromosome Location 14q24.3
Pathway ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Amphetamine addiction, organism-specific biosystem; Amphetamine addiction, conserved biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem;
Function R-SMAD binding; double-stranded DNA binding; protein binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOS Products

Required fields are marked with *

My Review for All FOS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon