Recombinant Human FOS protein, GST-tagged
Cat.No. : | FOS-32H |
Product Overview : | Recombinant Human FOS(1 a.a. - 380 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-380 a.a. |
Description : | The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 67.54 kDa |
AA Sequence : | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | FOS FBJ murine osteosarcoma viral oncogene homolog [ Homo sapiens ] |
Official Symbol | FOS |
Synonyms | FOS; FBJ murine osteosarcoma viral oncogene homolog; v fos FBJ murine osteosarcoma viral oncogene homolog; proto-oncogene c-Fos; AP 1; c fos; activator protein 1; cellular oncogene c-fos; G0/G1 switch regulatory protein 7; FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS); p55; AP-1; C-FOS; |
Gene ID | 2353 |
mRNA Refseq | NM_005252 |
Protein Refseq | NP_005243 |
MIM | 164810 |
UniProt ID | P01100 |
Chromosome Location | 14q24.3 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Amphetamine addiction, organism-specific biosystem; Amphetamine addiction, conserved biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; |
Function | R-SMAD binding; double-stranded DNA binding; protein binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
FOS-1026H | Recombinant Human FOS, His-tagged | +Inquiry |
FOS-1560R | Recombinant Rhesus Macaque FOS Protein, His (Fc)-Avi-tagged | +Inquiry |
FOS404H | Recombinant Human FOS Protein, His-tagged | +Inquiry |
FOS-3339H | Recombinant Human FOS Protein (Met1-Leu380), C-His tagged | +Inquiry |
FOS-5971M | Recombinant Mouse FOS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOS-6168HCL | Recombinant Human FOS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOS Products
Required fields are marked with *
My Review for All FOS Products
Required fields are marked with *