Recombinant Human GABARAP Protein, GST-tagged
Cat.No. : | GABARAP-4622H |
Product Overview : | Human GABARAP full-length ORF ( NP_009209.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. [provided by RefSeq |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GABARAP GABA(A) receptor-associated protein [ Homo sapiens ] |
Official Symbol | GABARAP |
Synonyms | GABARAP; GABA(A) receptor-associated protein; gamma-aminobutyric acid receptor-associated protein; ATG8A; MM46; GABARAP-a; FLJ25768; MGC120154; MGC120155; |
Gene ID | 11337 |
mRNA Refseq | NM_007278 |
Protein Refseq | NP_009209 |
MIM | 605125 |
UniProt ID | O95166 |
◆ Recombinant Proteins | ||
GABARAP-3421M | Recombinant Mouse GABARAP Protein, His (Fc)-Avi-tagged | +Inquiry |
GABARAP-937H | Recombinant Human GABARAP Protein, GST-tagged | +Inquiry |
GABARAP-5148HF | Recombinant Full Length Human GABARAP Protein, GST-tagged | +Inquiry |
GABARAP-4365H | Recombinant Human GABA(A) receptor-associated protein, His-tagged | +Inquiry |
GABARAP-26082TH | Recombinant Human GABARAP, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABARAP Products
Required fields are marked with *
My Review for All GABARAP Products
Required fields are marked with *
0
Inquiry Basket