Species : |
Human |
Source : |
E.coli |
Protein Length : |
111 |
Description : |
Bone Morphogenetic Protein-3B (BMP-3B), also known as Growth/Differentiation Factor 10 (GDF-10), is a cytokine belonging to the Transforming Growth Factor β (TGF-β) superfamily. BMP-3B contains the cystine knot motif shared by other TGF-β family members. BMP-3B was originally identified by PCR based on the BMP-3 sequence, and shares 83% identity with BMP-3. BMP-3B and BMP-2 act as mutual antagonists, as they compete for the availability of signaling protein Smad4. In vivo, BMP-3B is highly expressed in brain, lungs, and bone tissues. The functions of BMP-3B include acting as a dorsaling factor in head development, inhibition of adipogenesis in adipocytes, and induction of bone formation. BMP-3B is down-regulated in lung cancer patient samples, indicating its potential antitumor activity. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Molecular Mass : |
25.1 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : |
MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
Storage : |
Lyophilized recombinant human Bone Morphogenetic Protein-3B (rhBMP-3B) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhBMP-3B remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against 4mM HCl. |
Reconstitution : |
Reconstituted in 4mM HCl at 100 μg/mL. |