Recombinant Human GDF10 Protein (111 aa)
Cat.No. : | GDF10-436G |
Product Overview : | Recombinant human Bone Morphogenetic Protein-3B (rhBMP-3B) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 111 amino acids each. rhBMP-3B has a molecular mass of 25.1 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 111 |
Description : | Bone Morphogenetic Protein-3B (BMP-3B), also known as Growth/Differentiation Factor 10 (GDF-10), is a cytokine belonging to the Transforming Growth Factor β (TGF-β) superfamily. BMP-3B contains the cystine knot motif shared by other TGF-β family members. BMP-3B was originally identified by PCR based on the BMP-3 sequence, and shares 83% identity with BMP-3. BMP-3B and BMP-2 act as mutual antagonists, as they compete for the availability of signaling protein Smad4. In vivo, BMP-3B is highly expressed in brain, lungs, and bone tissues. The functions of BMP-3B include acting as a dorsaling factor in head development, inhibition of adipogenesis in adipocytes, and induction of bone formation. BMP-3B is down-regulated in lung cancer patient samples, indicating its potential antitumor activity. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Molecular Mass : | 25.1 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant human Bone Morphogenetic Protein-3B (rhBMP-3B) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhBMP-3B remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 4mM HCl. |
Reconstitution : | Reconstituted in 4mM HCl at 100 μg/mL. |
Gene Name | GDF10 growth differentiation factor 10 [ Homo sapiens ] |
Official Symbol | GDF10 |
Synonyms | GDF10; growth differentiation factor 10; bone morphogenetic protein 3B; BMP 3b; BIP; GDF-10; bone-inducing protein; BMP3B; BMP-3b; |
Gene ID | 2662 |
mRNA Refseq | NM_004962 |
Protein Refseq | NP_004953 |
MIM | 601361 |
UniProt ID | P55107 |
◆ Recombinant Proteins | ||
GDF10-436G | Recombinant Human GDF10 Protein (111 aa) | +Inquiry |
GDF10-284H | Recombinant Human GDF10 Protein, His-tagged | +Inquiry |
GDF10-2501R | Recombinant Rat GDF10 Protein | +Inquiry |
Gdf10-286M | Recombinant Mouse Gdf10 Protein, His-tagged | +Inquiry |
GDF10-3317H | Recombinant Human GDF10 Protein (369-478), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF10-2101MCL | Recombinant Mouse GDF10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF10 Products
Required fields are marked with *
My Review for All GDF10 Products
Required fields are marked with *
0
Inquiry Basket