Recombinant Human GDF10 Protein (111 aa)

Cat.No. : GDF10-436G
Product Overview : Recombinant human Bone Morphogenetic Protein-3B (rhBMP-3B) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 111 amino acids each. rhBMP-3B has a molecular mass of 25.1 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 111
Description : Bone Morphogenetic Protein-3B (BMP-3B), also known as Growth/Differentiation Factor 10 (GDF-10), is a cytokine belonging to the Transforming Growth Factor β (TGF-β) superfamily. BMP-3B contains the cystine knot motif shared by other TGF-β family members. BMP-3B was originally identified by PCR based on the BMP-3 sequence, and shares 83% identity with BMP-3. BMP-3B and BMP-2 act as mutual antagonists, as they compete for the availability of signaling protein Smad4. In vivo, BMP-3B is highly expressed in brain, lungs, and bone tissues. The functions of BMP-3B include acting as a dorsaling factor in head development, inhibition of adipogenesis in adipocytes, and induction of bone formation. BMP-3B is down-regulated in lung cancer patient samples, indicating its potential antitumor activity.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Molecular Mass : 25.1 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Bone Morphogenetic Protein-3B (rhBMP-3B) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhBMP-3B remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 4mM HCl.
Reconstitution : Reconstituted in 4mM HCl at 100 μg/mL.
Gene Name GDF10 growth differentiation factor 10 [ Homo sapiens ]
Official Symbol GDF10
Synonyms GDF10; growth differentiation factor 10; bone morphogenetic protein 3B; BMP 3b; BIP; GDF-10; bone-inducing protein; BMP3B; BMP-3b;
Gene ID 2662
mRNA Refseq NM_004962
Protein Refseq NP_004953
MIM 601361
UniProt ID P55107

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF10 Products

Required fields are marked with *

My Review for All GDF10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon