Recombinant Human GLRX Protein, GST-tagged
Cat.No. : | GLRX-4975H |
Product Overview : | Human GLRX full-length ORF ( AAH10965, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLRX glutaredoxin (thioltransferase) [ Homo sapiens ] |
Official Symbol | GLRX |
Synonyms | GLRX; glutaredoxin (thioltransferase); glutaredoxin-1; GRX; GRX1; TTase-1; thioltransferase-1; FLJ43648; MGC117407; |
Gene ID | 2745 |
mRNA Refseq | NM_001118890 |
Protein Refseq | NP_001112362 |
MIM | 600443 |
UniProt ID | P35754 |
◆ Recombinant Proteins | ||
GLRX-015H | Recombinant Human GLRX Protein | +Inquiry |
GLRX-5346HF | Recombinant Full Length Human GLRX Protein, GST-tagged | +Inquiry |
GLRX-4206H | Recombinant Human GLRX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLRX-166H | Recombinant Human GLRX Protein(Met1-Gln106), His-tagged | +Inquiry |
GLRX-139H | Recombinant Human GLRX Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX-5898HCL | Recombinant Human GLRX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX Products
Required fields are marked with *
My Review for All GLRX Products
Required fields are marked with *