Recombinant Human GRPR
Cat.No. : | GRPR-28627TH |
Product Overview : | Recombinant full length Human GRPR (amino acids 1-384) with N terminal proprietary tag; Predicted MWt 68.31 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 384 amino acids |
Description : | Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene. |
Molecular Weight : | 68.310kDa inclusive of tags |
Tissue specificity : | Highly expressed in pancreas. Also expressed in stomach, adrenal cortex and brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGIL YVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFIS SLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLK AAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYP HSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPF ALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS LKSTNPSVATFSLINGNICHERYV |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | GRPR gastrin-releasing peptide receptor [ Homo sapiens ] |
Official Symbol | GRPR |
Synonyms | GRPR; gastrin-releasing peptide receptor; |
Gene ID | 2925 |
mRNA Refseq | NM_005314 |
Protein Refseq | NP_005305 |
MIM | 305670 |
Uniprot ID | P30550 |
Chromosome Location | Xp22.2 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; |
Function | G-protein coupled peptide receptor activity; bombesin receptor activity; neuropeptide binding; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GRPR-3349H | Recombinant Human GRPR Protein (Met1-Lys114), N-GST tagged | +Inquiry |
GRPR-1981R | Recombinant Rhesus monkey GRPR Protein, His-tagged | +Inquiry |
GRPR-5610HF | Recombinant Full Length Human GRPR Protein, GST-tagged | +Inquiry |
Grpr-7836M | Recombinant Mouse Grpr protein, His & GST-tagged | +Inquiry |
GRPR-7295M | Recombinant Mouse GRPR Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRPR Products
Required fields are marked with *
My Review for All GRPR Products
Required fields are marked with *
0
Inquiry Basket