Recombinant Human GZMA Protein, GST-tagged
Cat.No. : | GZMA-4517H |
Product Overview : | Human GZMA full-length ORF ( NP_006135.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq |
Molecular Mass : | 55.4 kDa |
AA Sequence : | MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GZMA granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) [ Homo sapiens ] |
Official Symbol | GZMA |
Synonyms | GZMA; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); CTLA3, HFSP; granzyme A; CTL tryptase; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease); HF; h factor; fragmentin-1; cytotoxic T-lymphocyte proteinase 1; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); HFSP; CTLA3; |
Gene ID | 3001 |
mRNA Refseq | NM_006144 |
Protein Refseq | NP_006135 |
MIM | 140050 |
UniProt ID | P12544 |
◆ Recombinant Proteins | ||
GZMA-1713HFL | Recombinant Full Length Human GZMA Protein, C-Flag-tagged | +Inquiry |
Gzma-3009M | Recombinant Mouse Gzma protein, His-B2M-tagged | +Inquiry |
GZMA-4024M | Recombinant Mouse GZMA Protein, His (Fc)-Avi-tagged | +Inquiry |
Gzma-4519M | Recombinant Mouse Gzma Protein | +Inquiry |
GZMA-7410M | Recombinant Mouse GZMA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMA-5668HCL | Recombinant Human GZMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GZMA Products
Required fields are marked with *
My Review for All GZMA Products
Required fields are marked with *
0
Inquiry Basket