Recombinant Human HAMP Protein, GST-tagged
Cat.No. : | HAMP-4564H |
Product Overview : | Human HAMP full-length ORF ( AAH20612, 25 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq |
Molecular Mass : | 32.34 kDa |
AA Sequence : | SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HAMP hepcidin antimicrobial peptide [ Homo sapiens ] |
Official Symbol | HAMP |
Synonyms | HAMP; hepcidin antimicrobial peptide; hepcidin; HEPC; HFE2B; LEAP 1; LEAP1; putative liver tumor regressor; liver-expressed antimicrobial peptide 1; PLTR; |
Gene ID | 57817 |
mRNA Refseq | NM_021175 |
Protein Refseq | NP_066998 |
MIM | 606464 |
UniProt ID | P81172 |
◆ Recombinant Proteins | ||
HAMP-3454HF | Recombinant Full Length Human HAMP Protein, GST-tagged | +Inquiry |
HAMP-2059P | Recombinant Pig HAMP protein, His & GST-tagged | +Inquiry |
HAMP-3599H | Recombinant Human HAMP Protein (Asp60-Thr84), N-GST tagged | +Inquiry |
Hamp-532R | Recombinant Rat Hamp protein, His-KSI-tagged | +Inquiry |
Hamp-2060R | Recombinant Rat Hamp protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAMP-5640HCL | Recombinant Human HAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAMP Products
Required fields are marked with *
My Review for All HAMP Products
Required fields are marked with *