Recombinant Full Length Human HAMP Protein, GST-tagged

Cat.No. : HAMP-3454HF
Product Overview : Human HAMP full-length ORF ( AAH20612, 25 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 84 amino acids
Description : The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq
Molecular Mass : 32.34 kDa
AA Sequence : SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HAMP hepcidin antimicrobial peptide [ Homo sapiens ]
Official Symbol HAMP
Synonyms HAMP; hepcidin antimicrobial peptide; hepcidin; HEPC; HFE2B; LEAP 1; LEAP1; putative liver tumor regressor; liver-expressed antimicrobial peptide 1; PLTR;
Gene ID 57817
mRNA Refseq NM_021175
Protein Refseq NP_066998
MIM 606464
UniProt ID P81172

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HAMP Products

Required fields are marked with *

My Review for All HAMP Products

Required fields are marked with *

0
cart-icon