Recombinant Human HAVCR2 Protein, GST-tagged
Cat.No. : | HAVCR2-4591H |
Product Overview : | Human HAVCR2 full-length ORF ( AAH20843, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CD4 (MIM 186940)-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells and their associated cytokines are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. The 2 types of cells also cross-regulate the functions of the other. TIM3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.[supplied by OMIM |
Molecular Mass : | 41.36 kDa |
AA Sequence : | MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ] |
Official Symbol | HAVCR2 |
Synonyms | HAVCR2; hepatitis A virus cellular receptor 2; FLJ14428; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; T cell immunoglobulin mucin-3; T-cell immunoglobulin and mucin domain-containing protein 3; KIM-3; Tim-3; TIMD-3; HAVcr-2; |
Gene ID | 84868 |
mRNA Refseq | NM_032782 |
Protein Refseq | NP_116171 |
MIM | 606652 |
UniProt ID | Q8TDQ0 |
◆ Recombinant Proteins | ||
HAVCR2-734C | Recombinant Cynomolgus monkey HAVCR2 Protein, Fc-tagged | +Inquiry |
HAVCR2-3166HB | Recombinant Human HAVCR2 protein(Met1-Arg200), His-tagged, Amine-Labeled Biotinylated | +Inquiry |
HAVCR2-704H | Active Recombinant Human HAVCR2, Fc-tagged, Biotinylated | +Inquiry |
HAVCR2-877HAF647 | Recombinant Human HAVCR2 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
HAVCR2-0764H | Active Recombinant Human HAVCR2 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAVCR2-995MCL | Recombinant Mouse HAVCR2 cell lysate | +Inquiry |
HAVCR2-001CCL | Recombinant Cynomolgus HAVCR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAVCR2 Products
Required fields are marked with *
My Review for All HAVCR2 Products
Required fields are marked with *
0
Inquiry Basket