Recombinant Human HMGN1

Cat.No. : HMGN1-29327TH
Product Overview : Recombinant full length Human HMG14 with a proprietary tag; Predicted MWt 37.11.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes.
Molecular Weight : 37.110kDa
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
Sequence Similarities : Belongs to the HMGN family.
Gene Name HMGN1 high mobility group nucleosome binding domain 1 [ Homo sapiens ]
Official Symbol HMGN1
Synonyms HMGN1; high mobility group nucleosome binding domain 1; high mobility group (nonhistone chromosomal) protein 14 , high mobility group nucleosome binding domain 1 , HMG14; non-histone chromosomal protein HMG-14; FLJ27265; FLJ31471; high mobility group nuc
Gene ID 3150
mRNA Refseq NM_004965
Protein Refseq NP_004956
MIM 163920
Uniprot ID P05114
Chromosome Location 21q22.3
Pathway Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; p38 MAPK Signaling Pathway, organism-specific biosystem;
Function DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGN1 Products

Required fields are marked with *

My Review for All HMGN1 Products

Required fields are marked with *

0
cart-icon