Recombinant Human HSD17B3 Protein, GST-tagged

Cat.No. : HSD17B3-5070H
Product Overview : Human HSD17B3 full-length ORF ( NP_000188.1, 1 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq
Molecular Mass : 60.9 kDa
AA Sequence : MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSD17B3 hydroxysteroid (17-beta) dehydrogenase 3 [ Homo sapiens ]
Official Symbol HSD17B3
Synonyms HSD17B3; hydroxysteroid (17-beta) dehydrogenase 3; testosterone 17-beta-dehydrogenase 3; SDR12C2; short chain dehydrogenase/reductase family 12C; member 2; 17-beta-HSD3; 17-beta-HSD 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 12C, member 2; EDH17B3;
Gene ID 3293
mRNA Refseq NM_000197
Protein Refseq NP_000188
MIM 605573
UniProt ID P37058

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B3 Products

Required fields are marked with *

My Review for All HSD17B3 Products

Required fields are marked with *

0
cart-icon