Recombinant Full Length Human HSD17B3 Protein, GST-tagged
| Cat.No. : | HSD17B3-3857HF |
| Product Overview : | Human HSD17B3 full-length ORF ( NP_000188.1, 1 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 310 amino acids |
| Description : | This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq |
| Molecular Mass : | 60.9 kDa |
| AA Sequence : | MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSD17B3 hydroxysteroid (17-beta) dehydrogenase 3 [ Homo sapiens ] |
| Official Symbol | HSD17B3 |
| Synonyms | HSD17B3; hydroxysteroid (17-beta) dehydrogenase 3; testosterone 17-beta-dehydrogenase 3; SDR12C2; short chain dehydrogenase/reductase family 12C; member 2; 17-beta-HSD3; 17-beta-HSD 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 12C, member 2; EDH17B3; |
| Gene ID | 3293 |
| mRNA Refseq | NM_000197 |
| Protein Refseq | NP_000188 |
| MIM | 605573 |
| UniProt ID | P37058 |
| ◆ Recombinant Proteins | ||
| HSD17B3-7878M | Recombinant Mouse HSD17B3 Protein | +Inquiry |
| HSD17B3-2362H | Recombinant Human HSD17B3 Protein (Met1-Arg310), His tagged | +Inquiry |
| HSD17B3-2927R | Recombinant Rat HSD17B3 Protein | +Inquiry |
| HSD17B3-13959H | Recombinant Human HSD17B3, GST-tagged | +Inquiry |
| HSD17B3-1105H | Recombinant Human HSD17B3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD17B3-5374HCL | Recombinant Human HSD17B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B3 Products
Required fields are marked with *
My Review for All HSD17B3 Products
Required fields are marked with *




