Recombinant Human HSPA4 Protein, GST-tagged
Cat.No. : | HSPA4-5106H |
Product Overview : | Human HSPA4 full-length ORF ( AAH02526, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HSPA4 (Heat Shock Protein Family A (Hsp70) Member 4) is a Protein Coding gene. Diseases associated with HSPA4 include Ischemia and Salpingitis Isthmica Nodosa. Among its related pathways are CCR5 Pathway in Macrophages and Validated targets of C-MYC transcriptional activation. An important paralog of this gene is HSPA4L. |
Molecular Mass : | 42.02 kDa |
AA Sequence : | MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSPA4 heat shock 70kDa protein 4 [ Homo sapiens ] |
Official Symbol | HSPA4 |
Synonyms | HSPA4; heat shock 70kDa protein 4; heat shock 70kD protein 4; heat shock 70 kDa protein 4; HS24/P52; hsp70 RY; HSPH2; heat shock protein, 110 kDa; heat shock 70-related protein APG-2; RY; APG-2; hsp70; hsp70RY; MGC131852; |
Gene ID | 3308 |
mRNA Refseq | NM_002154 |
Protein Refseq | NP_002145 |
MIM | 601113 |
UniProt ID | P34932 |
◆ Recombinant Proteins | ||
Hspa4-1191M | Recombinant Mouse Hspa4 Protein, MYC/DDK-tagged | +Inquiry |
HSPA4-5743H | Recombinant Human HSPA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSPA4-5106H | Recombinant Human HSPA4 Protein, GST-tagged | +Inquiry |
HSPA4-2947R | Recombinant Rat HSPA4 Protein | +Inquiry |
HSPA4-2550H | Recombinant Human HSPA4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPA4-823HCL | Recombinant Human HSPA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPA4 Products
Required fields are marked with *
My Review for All HSPA4 Products
Required fields are marked with *
0
Inquiry Basket