Recombinant Human IFNK, GST-tagged

Cat.No. : IFNK-112H
Product Overview : Human IFNK full-length ORF ( 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster.
Molecular Mass : 51.6 kDa
AA Sequence : MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQY TQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIG LDQQAEYLNQCLEEDENENEDMKEMKENEMKP SEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IFNK interferon, kappa [ Homo sapiens (human) ]
Official Symbol IFNK
Synonyms IFNK; IFNT1; INFE1; RP11-27J8.1; interferon, kappa; interferon kappa; IFN-kappa; interferon-like protein
Gene ID 56832
mRNA Refseq NM_020124
Protein Refseq NP_064509
MIM 615326
UniProt ID Q9P0W0
Chromosome Location 9
Pathway Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; RIG-I-like receptor signaling pathway
Function cytokine activity; interferon-alpha/beta receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNK Products

Required fields are marked with *

My Review for All IFNK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon