Recombinant Human IFNK, GST-tagged
Cat.No. : | IFNK-112H |
Product Overview : | Human IFNK full-length ORF ( 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster. |
Molecular Mass : | 51.6 kDa |
AA Sequence : | MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQY TQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIG LDQQAEYLNQCLEEDENENEDMKEMKENEMKP SEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IFNK interferon, kappa [ Homo sapiens (human) ] |
Official Symbol | IFNK |
Synonyms | IFNK; IFNT1; INFE1; RP11-27J8.1; interferon, kappa; interferon kappa; IFN-kappa; interferon-like protein |
Gene ID | 56832 |
mRNA Refseq | NM_020124 |
Protein Refseq | NP_064509 |
MIM | 615326 |
UniProt ID | Q9P0W0 |
Chromosome Location | 9 |
Pathway | Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; RIG-I-like receptor signaling pathway |
Function | cytokine activity; interferon-alpha/beta receptor binding |
◆ Recombinant Proteins | ||
IFNK-5343H | Recombinant Human IFNK protein, His-PDI-tagged | +Inquiry |
IFNK-085H | Active Recombinant Human IFNK Protein | +Inquiry |
IFNK-2030R | Recombinant Rhesus Macaque IFNK Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNK-253HF | Recombinant Full Length Human IFNK Protein, GST-tagged | +Inquiry |
IFNK-2209R | Recombinant Rhesus monkey IFNK Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNK-837HCL | Recombinant Human IFNK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNK Products
Required fields are marked with *
My Review for All IFNK Products
Required fields are marked with *