Recombinant Human IFNK protein, His-PDI-tagged
Cat.No. : | IFNK-5343H |
Product Overview : | Recombinant Human IFNK protein(Q9P0W0)(28-207aa), fused with C-terminal His and PDI tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 28-207aa |
Tag : | C-His-PDI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 80.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK |
Gene Name | IFNK interferon, kappa [ Homo sapiens ] |
Official Symbol | IFNK |
Synonyms | IFNK; interferon, kappa; interferon kappa; IFN-kappa; interferon-like protein; RP11-27J8.1; |
Gene ID | 56832 |
mRNA Refseq | NM_020124 |
Protein Refseq | NP_064509 |
UniProt ID | Q9P0W0 |
◆ Recombinant Proteins | ||
IFNK-2209R | Recombinant Rhesus monkey IFNK Protein, His-tagged | +Inquiry |
IFNK-085H | Active Recombinant Human IFNK Protein | +Inquiry |
IFNK-253HF | Recombinant Full Length Human IFNK Protein, GST-tagged | +Inquiry |
IFNK-70H | Recombinant Human IFNK protein, His-SUMO-tagged | +Inquiry |
IFNK-68H | Recombinant Human Interferon Kappa, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNK-837HCL | Recombinant Human IFNK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNK Products
Required fields are marked with *
My Review for All IFNK Products
Required fields are marked with *