Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human IGF2, StrepII-tagged

Cat.No. : IGF2-212H
Product Overview : Purified, full-length human recombinant IGF2 protein (amino acids 93-126, 34 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 4 kDa. (Accession NP_000603.1; UniProt P01344)
  • Specification
  • Gene Information
  • Related Products
Description : IGF2 is a member of the insulin family of polypeptide growth factors, which are involved in development and growth. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome.
Source : Human Cells
Species : Human
Tag : StrepII
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length : 93-126, 34 a.a.
AA Sequence : DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name : IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ]
Official Symbol : IGF2
Synonyms : IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066;
Gene ID : 3481
mRNA Refseq : NM_000612
Protein Refseq : NP_000603
UniProt ID : P01344
Chromosome Location : 11p15.5
Pathway : Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem;
Function : growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; protein serine/threonine kinase activator activity; receptor activator activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends