Active Recombinant Human IL1B Protein
Cat.No. : | IL1B-132H |
Product Overview : | Recombinant human IL-1beta (117-269aa) without tag was expressed in E.coli and purified by using conventional chromatography techniques. |
Availability | May 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 117-269 a.a. |
Description : | Interleukin-1 (IL-1) has been considered a potentially important inflammatory mediator. It is composed of two distinct proteins, called as IL-1alpha and IL-1beta. IL-1beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and they are structurally related polypeptides that share approximately 20% amino acid. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is less or euqal to 0.005 ng/ml. |
Molecular Mass : | 17 kDa |
AA Sequence : | MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Endotoxin : | < 1.0 EU per 1 microgram of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Storage : | Can be stored at 4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by BCA assay) |
Storage Buffer : | PBS pH7.4 |
Gene Name | IL1B |
Official Symbol | IL1B interleukin 1 beta [ Homo sapiens (human) ] |
Synonyms | IL1B; interleukin 1 beta; IL-1; IL1F2; IL1-BETA; interleukin-1 beta; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta |
Gene ID | 3553 |
mRNA Refseq | NM_000576 |
Protein Refseq | NP_000567 |
MIM | 147720 |
UniProt ID | P01584 |
◆ Recombinant Proteins | ||
Il1b-383M | Active Recombinant Mouse Il1b protein | +Inquiry |
IL1B-2826C | Recombinant Cattle IL1B protein, His & T7-tagged | +Inquiry |
Il1b-101M | Active Recombinant Mouse Il1b Protein | +Inquiry |
IL1B-9908H | Active Recombinant Human IL1B | +Inquiry |
Il1B-464H | Active Recombinant Human Il1B, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
0
Inquiry Basket