Active Recombinant Human IL1RN Protein (153 aa)
Cat.No. : | IL1RN-104I |
Product Overview : | Recombinant Human IL1RN Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 153 |
Description : | Interleukin-1 receptor antagonist (IL-1ra) is a member of the IL-1 family. Endogenous IL-1ra is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL1-ra.The regulated expression of IL1ra in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts the synthesis of IL-1ra is markedly enhanced by IL-1, TNF-alpha, or PDGF. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant inhibition of IL-1 stimulation of D10S cells was found to be 0.5 ng/mL, corresponding to a Specific Activity of >2.0 × 10^6 IU/mg. |
Molecular Mass : | Approximately 17.0 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
AA Sequence : | MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Endotoxin : | Less than 1 EU/μg of rHuIL-1ra as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens ] |
Official Symbol | IL1RN |
Synonyms | IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; |
Gene ID | 3557 |
mRNA Refseq | NM_000577 |
Protein Refseq | NP_000568 |
MIM | 147679 |
UniProt ID | P18510 |
◆ Recombinant Proteins | ||
IL1RN-3596H | Recombinant Human IL1RN protein, His-tagged | +Inquiry |
IL1RN-3037R | Recombinant Rat IL1RN Protein | +Inquiry |
Il1rn-15856M | Recombinant Mouse Il1rn, His-tagged | +Inquiry |
IL1RN-4363R | Recombinant Rabbit IL1RN Protein | +Inquiry |
Il1rn-546M | Recombinant Mouse Il1rn protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket