Recombinant Mouse Il1rn protein

Cat.No. : Il1rn-546M
Product Overview : Recombinant Mouse Il1rn protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 152
Description : IL-1RA was initially called the IL-1 inhibitor which is encoded by the IL1RN gene and it is a member of the interleukin 1 cytokine family. IL-1RA is secreted by various types of cells including immune cells, epithelial cells, and adipocytes. IL-RA has functions of inhibiting the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. IL-1RA is also used in the treatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role. The murine IL-1RA is a single non-glycosylated polypeptide chain containing 152 amino acids and it has been shown to block the inflammatory responses induced by IL-1 both in vitro and in vivo. The protein shows 26 % amino acid homology to IL-1β and 19% homology to IL-1α. It also shares 90 % a.a. sequence identity with rat IL-1RA.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α-dependent proliferation of murine D10S cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg in the presence of 50 pg/ml rHuIL-1α.
Molecular Mass : Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids.
AA Sequence : RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Endotoxin : Less than 1 EU/µg of rMuIL-1RA as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il1rn
Official Symbol Il1rn
Synonyms IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; IRAP; IL-1RN; IL1 inhibitor; IL-1ra; F630041P17Rik;
Gene ID 16181
mRNA Refseq NM_001039701
Protein Refseq NP_001034790
UniProt ID Q542W1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1rn Products

Required fields are marked with *

My Review for All Il1rn Products

Required fields are marked with *

0
cart-icon