Recombinant Human IL2/diphtheria toxin, His-tagged therapeutic protein(Denileukin diftitox)
Cat.No. : | diphtheria toxin&IL2-P031H |
Product Overview : | A recombinant DNA-derived cytotoxic protein composed of the amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His followed by the sequences for interleukin-2 (IL-2; Ala 1-Thr 133). It is produced in an E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | diphtheria toxin fragments A and B (Met 1-Thr 387); IL-2(la 1-Thr 133) |
Description : | The expression product is the active ingredient of Ontak. |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNE NPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFA EGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDK TKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAV NVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIG FAAYNFVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNP KLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMC EYADETATIVEFLNRWITFCQSIISTLT |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | IL2; IL 2; TCGF; IL-2; Denileukin diftitox |
Gene Name | IL2 interleukin 2 [ Homo sapiens ] |
Official Symbol | IL2 |
Synonyms | IL2; interleukin 2; interleukin-2; IL 2; T cell growth factor; TCGF; aldesleukin; involved in regulation of T-cell clonal expansion; IL-2; lymphokine; |
Gene ID | 3558 |
mRNA Refseq | NM_000586 |
Protein Refseq | NP_000577 |
MIM | 147680 |
UniProt ID | P60568 |
Chromosome Location | 4q26-q27 |
Pathway | Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; |
Function | carbohydrate binding; cytokine activity; glycosphingolipid binding; growth factor activity; interleukin-2 receptor binding; interleukin-2 receptor binding; kappa-type opioid receptor binding; kinase activator activity; |
◆ Recombinant Proteins | ||
IL2-1027P | Recombinant Pig IL2 Protein, His-tagged | +Inquiry |
Il2-57M | Active Recombinant Mouse Il2 Protein (Ala21-Gln169), C-His tagged, Animal-free, Carrier-free | +Inquiry |
ll2-538M | Recombinant Mouse Interleukin 2, His-tagged | +Inquiry |
IL2-0016H | Recombinant Human IL2 Protein | +Inquiry |
IL2-0182H | Active Recombinant Human IL2 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *
0
Inquiry Basket