Recombinant Human IL21R Protein, C-His-tagged
Cat.No. : | IL21R-109H |
Product Overview : | Recombinant Human IL21R Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The IL-21 receptor (also designated IL-21R, NILR or novel interleukin receptor) is a type I cytokine receptor that forms a complex with the cytokine receptor γ chain, γc and mediates IL-21 signaling. IL-21R is present on the surface of natural killer, B and T cell populations with high levels in spleen and thymus. IL-21 and IL-21R influence lymphoid proliferation and early lymphoid development in the transition between innate and adaptive immunity. Tumor necrosis factor (TNF) upregulates IL-21R, and combinations of TNF and IL-21 can have synergistic effects on myeloma cell proliferation through pathways involving phosphorylation of JAK1, Stat3 and Erk1/2. The human IL-21R gene maps to chromosome 16p12.1 and encodes a 538 amino acid protein that is closely related to human IL2RB and shares 62% sequence identity to mouse Il21r. |
Molecular Mass : | ~23 kDa |
AA Sequence : | CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | IL21R interleukin 21 receptor [ Homo sapiens (human) ] |
Official Symbol | IL21R |
Synonyms | IL21R; interleukin 21 receptor; interleukin-21 receptor; CD360; IL-21R; IL-21 receptor; novel interleukin receptor; NILR; MGC10967; |
Gene ID | 50615 |
mRNA Refseq | NM_021798 |
Protein Refseq | NP_068570 |
MIM | 605383 |
UniProt ID | Q9HBE5 |
◆ Recombinant Proteins | ||
IL21R-2355C | Recombinant Cynomolgus/Rhesus IL21R protein(Met1-Pro236), hFc-tagged | +Inquiry |
Il21r-1627H | Recombinant Human Il21r protein, hFc-tagged | +Inquiry |
IL21R-1464C | Recombinant Cynomolgus IL21R protein, His-tagged | +Inquiry |
Il21r-10582M | Recombinant Mouse Il21r Protein, His (Fc)-Avi-tagged | +Inquiry |
Il21r-448M | Recombinant Mouse Il21r protein(Met1-Pro236), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21R-1442RCL | Recombinant Rat IL21R cell lysate | +Inquiry |
IL21R-001CCL | Recombinant Cynomolgus IL21R cell lysate | +Inquiry |
IL21R-2019HCL | Recombinant Human IL21R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21R Products
Required fields are marked with *
My Review for All IL21R Products
Required fields are marked with *
0
Inquiry Basket